Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivated CDC42 kinase 1
LigandBDBM50421257
Substrate/Competitorn/a
Meas. Tech.ChEMBL_840100
IC50 10±n/a nM
Citation Jiao, XKopecky, DJLiu, JLiu, JJaen, JCCardozo, MGSharma, RWalker, NWesche, HLi, SFarrelly, EXiao, SHWang, ZKayser, F Synthesis and optimization of substituted furo[2,3-d]-pyrimidin-4-amines and 7H-pyrrolo[2,3-d]pyrimidin-4-amines as ACK1 inhibitors. Bioorg Med Chem Lett22:6212-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activated CDC42 kinase 1
Name:Activated CDC42 kinase 1
Synonyms:ACK-1 | Ack1 | Non-receptor protein tyrosine kinase Ack
Type:PROTEIN
Mol. Mass.:116986.19
Organism:Mus musculus
Description:ChEMBL_840100
Residue:1055
Sequence:
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCL
IGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTLPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
AYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
RIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKREPPPRPPQPAIFTQKTTYDPVSEDP
DPLSSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPC
APSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF
EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAE
IFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEE
TSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDP
KYATPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEP
AALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRAAARLPQ
RGCPGDGQEAARPADKVQMLQAMVHGVTTEECQAALQSHSWSVQRAAQYLKVEQLFGLGL
RPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHKR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50421257
n/a
NameBDBM50421257
Synonyms:CHEMBL2087875
TypeSmall organic molecule
Emp. Form.C28H31N5OS2
Mol. Mass.517.709
SMILESC(CN1CCCC1)Oc1ccc(cc1)-c1[nH]c2ncnc(NCC3SCCS3)c2c1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: