Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50001922
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30096
EC50 63±n/a nM
Citation Bishop, MJBerman, JBigham, ECGarrison, DTGobel, MJHodson, SJIrving, PELiacos, JAMinick, DJNavas, FSaussy, DLSpeake, JD 2-(Anilinomethyl)imidazolines as alpha(1)-adrenoceptor agonists: the identification of alpha(1A) subtype selective 2'-carboxylic acid esters and amides. Bioorg Med Chem Lett11:2871-4 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha-1A adrenergic receptor
Synonyms:ADRA1A | ADRA1C | Adrenergic alpha1A | Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha adrenergic receptor 1a | Alpha-1C adrenergic receptor | Alpha-adrenergic receptor 1c | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1 | adrenergic Alpha1C
Type:Cell-surface receptors
Mol. Mass.:51511.67
Organism:Homo sapiens (Human)
Description:P35348
Residue:466
Sequence:
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001922
NameBDBM50001922
Synonyms:2-Naphthalen-1-ylmethyl-4,5-dihydro-1H-imidazole; hydrochloride | Albalon | CHEMBL1706 | NAPHAZOLINE | NAPHAZOLINE HYDROCHLORIDE | Nafazair | Naphazoline | Naphazoline Nitrate | Naphcon forte | Opcon | Vasocon | cid_11079
TypeSmall organic molecule
Emp. Form.C14H14N2
Mol. Mass.210.2744
SMILESC(C1=NCCN1)c1cccc2ccccc12 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a