Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha adrenergic receptor (1a and 1d)
LigandBDBM50421593
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32583
IC50 54±n/a nM
Citation Bishop, MJBarvian, KABerman, JBigham, ECGarrison, DTGobel, MJHodson, SJIrving, PELiacos, JANavas, FSaussy, DLSpeake, JD alpha(1)-Adrenoceptor agonists: the identification of novel alpha(1A )subtype selective 2'-heteroaryl-2-(phenoxymethyl)imidazolines. Bioorg Med Chem Lett12:471-5 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha adrenergic receptor (1a and 1d)
Name:Adrenergic receptor alpha
Synonyms:Adrenergic receptor alpha | Alpha 1D-adrenoceptor | Alpha 1D-adrenoreceptor | Alpha-1D adrenergic receptor | Alpha-adrenergic receptor 1a | adrenergic Alpha1D
Type:Enzyme Catalytic Domain
Mol. Mass.:60485.82
Organism:HUMAN
Description:adrenergic Alpha1D ADRA1D HUMAN::P25100
Residue:572
Sequence:
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50421593
n/a
NameBDBM50421593
Synonyms:CHEMBL357129
TypeSmall organic molecule
Emp. Form.C14H15N3O
Mol. Mass.241.2884
SMILESC(Oc1ccccc1-c1ccc[nH]1)C1=NCCN1 |t:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: