Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha adrenergic receptor (1a and 1d)
LigandBDBM50421602
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32584
IC50 43±n/a nM
Citation Navas, FBishop, MJGarrison, DTHodson, SJSpeake, JDBigham, ECDrewry, DHSaussy, DLLiacos, JHIrving, PEGobel, MJ 2-(anilinomethyl)imidazolines as alpha1A adrenergic receptor agonists: 2'-heteroaryl and 2'-oxime ether series. Bioorg Med Chem Lett12:575-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha adrenergic receptor (1a and 1d)
Name:Adrenergic receptor alpha
Synonyms:Adrenergic receptor alpha | Alpha 1D-adrenoceptor | Alpha 1D-adrenoreceptor | Alpha-1D adrenergic receptor | Alpha-adrenergic receptor 1a | adrenergic Alpha1D
Type:Enzyme Catalytic Domain
Mol. Mass.:60485.82
Organism:HUMAN
Description:adrenergic Alpha1D ADRA1D HUMAN::P25100
Residue:572
Sequence:
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50421602
n/a
NameBDBM50421602
Synonyms:CHEMBL351542
TypeSmall organic molecule
Emp. Form.C12H16N4O
Mol. Mass.232.2816
SMILESCO\N=C\c1ccccc1NCC1=NCCN1 |t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: