Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50405971
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54240
IC50 66±n/a nM
Citation Roth, BRauckman, BSFerone, RBaccanari, DPChampness, JNHyde, RM 2,4-Diamino-5-benzylpyrimidines as antibacterial agents. 7. Analysis of the effect of 3,5-dialkyl substituent size and shape on binding to four different dihydrofolate reductase enzymes. J Med Chem30:348-56 (1987) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:Dihydrofolate reductase (F31V) | dfrA17
Type:n/a
Mol. Mass.:17532.46
Organism:Escherichia coli
Description:n/a
Residue:157
Sequence:
MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405971
NameBDBM50405971
Synonyms:CHEMBL59369
TypeSmall organic molecule
Emp. Form.C12H14N4O2
Mol. Mass.246.2652
SMILESCOc1cc(Cc2cnc(N)nc2N)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a