Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50421786
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54785
IC50 250000±n/a nM
Citation Roth, BRauckman, BSFerone, RBaccanari, DPChampness, JNHyde, RM 2,4-Diamino-5-benzylpyrimidines as antibacterial agents. 7. Analysis of the effect of 3,5-dialkyl substituent size and shape on binding to four different dihydrofolate reductase enzymes. J Med Chem30:348-56 (1987) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase; P. carinii vs rat
Synonyms:Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase
Type:Enzyme
Mol. Mass.:21638.84
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50421786
NameBDBM50421786
Synonyms:CHEMBL287553
TypeSmall organic molecule
Emp. Form.C14H18N4O
Mol. Mass.258.3189
SMILESCOc1c(C)cc(Cc2cnc(N)nc2N)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a