Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 7 (CDK7)
LigandBDBM50423756
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612600
Ki 53±n/a nM
Citation McIntyre, NAMcInnes, CGriffiths, GBarnett, ALKontopidis, GSlawin, AMJackson, WThomas, MZheleva, DIWang, SBlake, DGWestwood, NJFischer, PM Design, synthesis, and evaluation of 2-methyl- and 2-amino-N-aryl-4,5-dihydrothiazolo[4,5-h]quinazolin-8-amines as ring-constrained 2-anilino-4-(thiazol-5-yl)pyrimidine cyclin-dependent kinase inhibitors. J Med Chem53:2136-45 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 7 (CDK7)
Name:Cyclin-Dependent Kinase 7 (CDK7)
Synonyms:CDK-activating kinase assembly factor MAT1/Cyclin H/Cyclin-dependent kinase 7 | CDK7/Cyclin H | Cyclin H/dependent kinase 7 | Cyclin-dependent kinase 7/ cyclin H | Cyclin-dependent kinase 7/cyclin H
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:CDK7/Cyclin H/MNAT1
Synonyms:Cyclin H | Cyclin-H | MO15-associated protein | p34 | p37
Type:Enzyme Subunit
Mol. Mass.:37646.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:323
Sequence:
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:CDK7/Cyclin H/MNAT1
Synonyms:39 kDa protein kinase | CAK1 | CDK-activating kinase | CDK-activating kinase 1 (CAK) | CDK7 | Cell division protein kinase 7 | Cyclin-Dependent Kinase 7 (CDK7) | Cyclin-dependent kinase 7 | Cyclin-dependent kinase 7 (CDK7/cyclin H) | P39 Mo15 | STK1 | TFIIH basal transcription factor complex kinase subunit
Type:Enzyme Subunit
Mol. Mass.:39047.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:346
Sequence:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50423756
NameBDBM50423756
Synonyms:CHEMBL611995
TypeSmall organic molecule
Emp. Form.C16H14N4OS
Mol. Mass.310.374
SMILESCc1nc2CCc3cnc(Nc4cccc(O)c4)nc3-c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a