Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic receptor M2 and M3
LigandBDBM50423968
Substrate/Competitorn/a
Meas. Tech.ChEMBL_935576
EC50 640±n/a nM
Citation Le, UMelancon, BJBridges, TMVinson, PNUtley, TJLamsal, ARodriguez, ALVenable, DSheffler, DJJones, CKBlobaum, ALWood, MRDaniels, JSConn, PJNiswender, CMLindsley, CWHopkins, CR Discovery of a selective M4 positive allosteric modulator based on the 3-amino-thieno[2,3-b]pyridine-2-carboxamide scaffold: development of ML253, a potent and brain penetrant compound that is active in a preclinical model of schizophrenia. Bioorg Med Chem Lett23:346-50 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic receptor M2 and M3
Name:Muscarinic receptor M1 and M2
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:Cholinergic, muscarinic 0 RAT::P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50423968
NameBDBM50423968
Synonyms:CHEMBL2313377
TypeSmall organic molecule
Emp. Form.C13H14ClN3OS
Mol. Mass.295.788
SMILESCc1nc2sc(C(=O)NC3CC3)c(N)c2c(C)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a