Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 9 (CDK9)
LigandBDBM50425007
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936301
Ki 8±n/a nM
Citation Hole, AJBaumli, SShao, HShi, SHuang, SPepper, CFischer, PMWang, SEndicott, JANoble, ME Comparative structural and functional studies of 4-(thiazol-5-yl)-2-(phenylamino)pyrimidine-5-carbonitrile CDK9 inhibitors suggest the basis for isotype selectivity. J Med Chem56:660-70 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 9 (CDK9)
Name:Cyclin-Dependent Kinase 9 (CDK9)
Synonyms:CDK9/ Cyclin-T1 | CDK9/CycT1 | CDK9/Cyclin T | CDK9/Cyclin T1 | Cyclin T1/dependent kinase 9
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cyclin-T1
Synonyms:CycT | CycT1 | Cyclin T | Cyclin T1 | Cyclin-T
Type:Enzyme Subunit
Mol. Mass.:80712.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:726
Sequence:
MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLM
SMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGV
DHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEI
KMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNK
RPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSL
NFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDT
VNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPP
LPPLPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cyclin-dependent kinase 9
Synonyms:C-2K | CDC2L4 | CDK9 | Cell division cycle 2-like protein kinase 4 | Cell division protein kinase 9 | Cyclin-Dependent Kinase 9 (CDK9) | Cyclin-dependent kinase 9 (CDK9) | Serine/threonine-protein kinase PITALRE | TAK | Tat-associated kinase complex catalytic subunit
Type:Enzyme Subunit
Mol. Mass.:42789.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50425007
NameBDBM50425007
Synonyms:CHEMBL2312186
TypeSmall organic molecule
Emp. Form.C20H21N7O3S2
Mol. Mass.471.556
SMILESCNc1nc(C)c(s1)-c1nc(Nc2ccc(cc2)S(=O)(=O)N2CCOCC2)ncc1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a