Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor 1 (GluA1)
LigandBDBM50425998
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934591
IC50 167±n/a nM
Citation Poulsen, MHLucas, SBach, TBBarslund, AFWenzler, CJensen, CBKristensen, ASStrømgaard, K Structure-activity relationship studies of argiotoxins: selective and potent inhibitors of ionotropic glutamate receptors. J Med Chem56:1171-81 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor 1 (GluA1)
Name:Glutamate receptor AMPA 1/2
Synonyms:Glutamate receptor ionotropic, AMPA 1
Type:Protein
Mol. Mass.:101583.91
Organism:Rattus norvegicus (Rat)
Description:P19490
Residue:907
Sequence:
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGM
PLGATGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50425998
NameBDBM50425998
Synonyms:CHEMBL2314927
TypeSmall organic molecule
Emp. Form.C29H50N8O7
Mol. Mass.622.7567
SMILES[#7]-[#6@H](-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6]-[#6]-[#6]-[#6]-[#6]-[#7]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#8])=O)-[#7]-[#6](=O)-[#6]-c1ccc(-[#8])cc1-[#8] |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a