Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExcitatory amino acid transporter 3
LigandBDBM50426293
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936435
IC50>300000±n/a nM
Citation Assaf, ZLarsen, APVenskutonyte, RHan, LAbrahamsen, BNielsen, BGajhede, MKastrup, JSJensen, AAPickering, DSFrydenvang, KGefflaut, TBunch, L Chemoenzymatic synthesis of new 2,4-syn-functionalized (S)-glutamate analogues and structure-activity relationship studies at ionotropic glutamate receptors and excitatory amino acid transporters. J Med Chem56:1614-28 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Excitatory amino acid transporter 3
Name:Excitatory amino acid transporter 3
Synonyms:Excitatory Amino Acid EAAT3
Type:Enzyme Catalytic Domain
Mol. Mass.:57096.71
Organism:Homo sapiens (Human)
Description:Excitatory Amino Acid EAAT3 0 HUMAN::P43005
Residue:524
Sequence:
MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGV
TQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMT
EESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426293
NameBDBM50426293
Synonyms:CHEMBL2312400
TypeSmall organic molecule
Emp. Form.C13H22N2O5
Mol. Mass.286.3242
SMILESN[C@@H](C[C@@H](CCC(=O)N1CCCCC1)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a