Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic, kainate
LigandBDBM50426287
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936438
Ki 10200±n/a nM
Citation Assaf, ZLarsen, APVenskutonyte, RHan, LAbrahamsen, BNielsen, BGajhede, MKastrup, JSJensen, AAPickering, DSFrydenvang, KGefflaut, TBunch, L Chemoenzymatic synthesis of new 2,4-syn-functionalized (S)-glutamate analogues and structure-activity relationship studies at ionotropic glutamate receptors and excitatory amino acid transporters. J Med Chem56:1614-28 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic, kainate
Name:Glutamate receptor ionotropic, kainate
Synonyms:Glutamate receptor ionotropic kainate 3
Type:PROTEIN
Mol. Mass.:104080.46
Organism:Rattus norvegicus
Description:ChEMBL_1447329
Residue:919
Sequence:
MTAPWRRLRSLVWEYWAGFLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNA
VQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQSLKWRSATVVYD
DSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQ
ILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNAHVSAIVEKWS
MERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQRASQMTVNSLQCHRHKPWRFGG
RFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGVWSPADGLNITEVA
KGRGPNVTDSLTNRSLIVTTLLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFS
YEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
SILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPG
SEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAF
LTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVK
NNEEGIQRTLTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKIT
IAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAV
GEFIYKLRKTAEREQRSFCSTVADEIRFSLTCQRRLKHKPQPPMMVKTDAVINMHTFNDR
RLPGKDSMSCSTSLAPVFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426287
NameBDBM50426287
Synonyms:CHEMBL2312685
TypeSmall organic molecule
Emp. Form.C8H16N2O4
Mol. Mass.204.2236
SMILESNCCC[C@H](C[C@H](N)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a