Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIonotropic glutamate receptor kainate 2/5
LigandBDBM50426289
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936439
Ki 3270±n/a nM
Citation Assaf, ZLarsen, APVenskutonyte, RHan, LAbrahamsen, BNielsen, BGajhede, MKastrup, JSJensen, AAPickering, DSFrydenvang, KGefflaut, TBunch, L Chemoenzymatic synthesis of new 2,4-syn-functionalized (S)-glutamate analogues and structure-activity relationship studies at ionotropic glutamate receptors and excitatory amino acid transporters. J Med Chem56:1614-28 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ionotropic glutamate receptor kainate 2/5
Name:Ionotropic glutamate receptor kainate 2/5
Synonyms:Glutamate receptor ionotropic kainate 2
Type:PROTEIN
Mol. Mass.:102478.61
Organism:Rattus norvegicus
Description:ChEMBL_936439
Residue:908
Sequence:
MKIISPVLSNLVFSRSIKVLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426289
NameBDBM50426289
Synonyms:CHEMBL2312683
TypeSmall organic molecule
Emp. Form.C8H14N2O6
Mol. Mass.234.2066
SMILESN[C@@H](C[C@@H](CCC(=O)NO)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a