Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA1B
LigandBDBM50328477
Substrate/Competitorn/a
Meas. Tech.ChEMBL_939352
Ki 1.9±n/a nM
Citation Jørgensen, MJørgensen, PNChristoffersen, CTJensen, KGBalle, TBang-Andersen, B Discovery of novela1-adrenoceptor ligands based on the antipsychotic sertindole suitable for labeling as PET ligands. Bioorg Med Chem21:196-204 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADRA1B
Name:ADRA1B
Synonyms:Adrenergic receptor alpha | Alpha-1b adrenergic receptor | adrenergic Alpha1B
Type:Enzyme Catalytic Domain
Mol. Mass.:56514.13
Organism:C.H.O.
Description:adrenergic Alpha1B ADRA1B C.H.O.::P18841
Residue:515
Sequence:
MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLP
SASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESP
GTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328477
NameBDBM50328477
Synonyms:1-(8-chloro-10,11-dihydrodibenzo[b,f]thiepin-10-yl)-4-methylpiperazine | CHEMBL1259203
TypeSmall organic molecule
Emp. Form.C24H23FN4
Mol. Mass.386.4646
SMILESCN1CCC(CC1)c1cn(-c2ccc(F)cc2)c2ccc(cc12)-c1cncnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a