Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNEDD8-activating enzyme E1 regulatory subunit
LigandBDBM50427031
Substrate/Competitorn/a
Meas. Tech.ChEMBL_939689
IC50 800±n/a nM
Citation da Silva, SRPaiva, SLLukkarila, JLGunning, PT Exploring a new frontier in cancer treatment: targeting the ubiquitin and ubiquitin-like activating enzymes. J Med Chem56:2165-77 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NEDD8-activating enzyme E1 regulatory subunit
Name:NEDD8-activating enzyme E1 regulatory subunit
Synonyms:APP-BP1 | APPBP1 | Amyloid beta precursor protein-binding protein 1, 59 kDa | Amyloid protein-binding protein 1 | NAE1 | Proto-oncogene protein 1
Type:PROTEIN
Mol. Mass.:60233.54
Organism:Homo sapiens
Description:ChEMBL_939705
Residue:534
Sequence:
MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTII
DGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFF
CRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNAL
EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEK
EDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQ
TPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNH
VAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVH
EFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427031
n/a
NameBDBM50427031
Synonyms:CHEMBL2322197
TypeSmall organic molecule
Emp. Form.C17H18N4O6
Mol. Mass.374.348
SMILESOC(=O)CNC(=O)CNC(=O)COc1ccc2nc3CCCn3c(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: