Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, epsilon
LigandBDBM50427363
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941100
Ki 1.000000±n/a nM
Citation Jimenez, JMBoyall, DBrenchley, GCollier, PNDavis, CJFraysse, DKeily, SBHenderson, JMiller, APierard, FSettimo, LTwin, HCBolton, CMCurnock, APChiu, PTanner, AJYoung, S Design and optimization of selective protein kinase C¿ (PKC¿) inhibitors for the treatment of autoimmune diseases. J Med Chem56:1799-810 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, epsilon
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC epsilon | Protein kinase C epsilon type | nPKC-epsilon
Type:Enzyme
Mol. Mass.:83680.45
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:737
Sequence:
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427363
NameBDBM50427363
Synonyms:CHEMBL2326002
TypeSmall organic molecule
Emp. Form.C20H24ClFN6O
Mol. Mass.418.896
SMILESCC(C)[C@@](C)(O)[C@@H]1CN(CCN1)c1nc(-c2n[nH]c3ncccc23)c(F)cc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a