Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C theta type
LigandBDBM50427381
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941193
Ki 5.0±n/a nM
Citation Jimenez, JMBoyall, DBrenchley, GCollier, PNDavis, CJFraysse, DKeily, SBHenderson, JMiller, APierard, FSettimo, LTwin, HCBolton, CMCurnock, APChiu, PTanner, AJYoung, S Design and optimization of selective protein kinase C¿ (PKC¿) inhibitors for the treatment of autoimmune diseases. J Med Chem56:1799-810 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C theta type
Name:Protein kinase C theta type
Synonyms:PRKCQ | PRKCT | Protein kinase C theta | Protein kinase C theta type (PRKCQ) | nPKC-theta
Type:Serine/threonine-protein kinase
Mol. Mass.:81878.04
Organism:Homo sapiens (Human)
Description:Full-length human PKC theta (Panvera Catalog No. P2996).
Residue:706
Sequence:
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427381
NameBDBM50427381
Synonyms:CHEMBL2326020
TypeSmall organic molecule
Emp. Form.C21H20N6
Mol. Mass.356.4237
SMILESC1CN(C[C@H](N1)c1ccccc1)c1cccc(n1)-c1n[nH]c2ncccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a