Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50428443
Substrate/Competitorn/a
Meas. Tech.ChEMBL_942138
Ki 0.500000±n/a nM
Citation Syrjänen, LTolvanen, MEHilvo, MVullo, DCarta, FSupuran, CTParkkila, S Characterization, bioinformatic analysis and dithiocarbamate inhibition studies of two newa-carbonic anhydrases, CAH1 and CAH2, from the fruit fly Drosophila melanogaster. Bioorg Med Chem21:1516-21 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase 1
Synonyms:CAH1 | Dmel_CG7820 | GH09688p
Type:PROTEIN
Mol. Mass.:29950.70
Organism:Drosophila melanogaster
Description:ChEMBL_942138
Residue:270
Sequence:
MSHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKS
LVNPGYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELH
LVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQG
CDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEEC
PCNEFNGKVINNFRPPLPLGKRELREIGGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428443
NameBDBM50428443
Synonyms:CHEMBL2334360
TypeSmall organic molecule
Emp. Form.C5H4NS3
Mol. Mass.174.288
SMILES[S-]C(=S)Nc1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a