Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral ceramidase
LigandBDBM50428951
Substrate/Competitorn/a
Meas. Tech.ChEMBL_947546
IC50 120000±n/a nM
Citation Bhabak, KPKleuser, BHuwiler, AArenz, C Effective inhibition of acid and neutral ceramidases by novel B-13 and LCL-464 analogues. Bioorg Med Chem21:874-82 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neutral ceramidase
Name:Neutral ceramidase
Synonyms:ASAH2 | Acylsphingosine deacylase 2 | BCDase | HNAC1 | LCDase | N-CDase | N-acylsphingosine amidohydrolase 2 | NCDase | Neutral ceramidase soluble form | Non-lysosomal ceramidase | hCD
Type:PROTEIN
Mol. Mass.:85523.37
Organism:Homo sapiens
Description:ChEMBL_947546
Residue:780
Sequence:
MAKRTFSNLETFLIFLLVMMSAITVALLSLLFITSGTIENHKDLGGHFFSTTQSPPATQG
STAAQRSTATQHSTATQSSTATQTSPVPLTPESPLFQNFSGYHIGVGRADCTGQVADINL
MGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYG
SLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKP
GKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWF
AIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQGPFVAAFASSNLGDVSPNILGP
RCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQEVT
GPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFW
DTIRDQILGKPSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGE
FTTMSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTHYITTYEEYQAQRYEAASTIYGP
HTLSAYIQLFRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQ
PAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFY
WHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428951
n/a
NameBDBM50428951
Synonyms:CHEMBL2333179
TypeSmall organic molecule
Emp. Form.C23H40N2O2
Mol. Mass.376.5759
SMILESC[C@@H](NC(=O)CCCCCCCCCCCN(C)C)[C@@H](O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: