Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-coenzyme A:cholesterol acyltransferase 2 (ACAT2)
LigandBDBM50429596
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945256
IC50 4.0±n/a nM
Citation Ohtawa, MYamazaki, HOhte, SMatsuda, DOhshiro, TRudel, LLOmura, STomoda, HNagamitsu, T Synthesis and structure-activity relationship of pyripyropene A derivatives as potent and selective acyl-CoA:cholesterol acyltransferase 2 (ACAT2) inhibitors: part 1. Bioorg Med Chem Lett23:1285-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-coenzyme A:cholesterol acyltransferase 2 (ACAT2)
Name:Acyl coenzyme A:cholesterol acyltransferase 2
Synonyms:ACAT-2 | Acetyl-CoA acetyltransferase, cytosolic | Acetyl-CoA transferase-like protein | Acyl coenzyme A:cholesterol acyltransferase 2 | Cholesterol acyltransferase 2 | Cytosolic acetoacetyl-CoA thiolase | Sterol O-acyltransferase 2
Type:Enzyme
Mol. Mass.:59912.75
Organism:Homo sapiens (Human)
Description:O75908
Residue:522
Sequence:
MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQL
RELLDRAMREAIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHF
RTIYHMFIAGLCVFIISTLAIDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLA
PYQALRLWARGTWTQATGLGCALLAAHAVVLCALPVHVAVEHQLPPASRCVLVFEQVRFL
MKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTLIYRETYPRTPYVRWNYVAKN
FAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFMLLLIFFAFLH
CWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTM
LFLGQGIQVSLYCQEWYARRHCPLPQATFWGLVTPRSWSCHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429596
n/a
NameBDBM50429596
Synonyms:CHEMBL2333813
TypeSmall organic molecule
Emp. Form.C36H38INO10
Mol. Mass.771.5921
SMILESCC(=O)OC[C@]1(C)[C@H](CC[C@@]2(C)[C@H]1C[C@H](OC(=O)c1ccc(I)cc1)[C@@]1(C)Oc3cc(oc(=O)c3[C@H](O)[C@H]21)-c1cccnc1)OC(C)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: