Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
LigandBDBM50429815
Substrate/Competitorn/a
Meas. Tech.ChEMBL_948650
Ki 77±n/a nM
Citation Nuti, ESantamaria, SCasalini, FYamamoto, KMarinelli, LLa Pietra, VNovellino, EOrlandini, ENencetti, SMarini, AMSalerno, STaliani, SDa Settimo, FNagase, HRossello, A Arylsulfonamide inhibitors of aggrecanases as potential therapeutic agents for osteoarthritis: synthesis and biological evaluation. Eur J Med Chem62:379-94 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Name:A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Synonyms:ADAMTS5 | Aggrecanase-2 | Metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Type:Enzyme
Mol. Mass.:101769.09
Organism:Homo sapiens (Human)
Description:Q9UNA0
Residue:930
Sequence:
MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGH
PHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGT
SAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGR
VYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLD
QSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMARLYGRGLQHYLLTLASIANR
LYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYD
AAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQI
LGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGT
PCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPR
NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVL
PADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVRGKCVRTGCDGIIGSKLQYDK
CGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKK
NGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTV
QCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429815
n/a
NameBDBM50429815
Synonyms:CHEMBL2337698
TypeSmall organic molecule
Emp. Form.C15H14ClFN2O5S
Mol. Mass.388.798
SMILESONC(=O)CNS(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: