Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis Signal-regulating Kinase 1 (ASK1)
LigandBDBM50429867
Substrate/Competitorn/a
Meas. Tech.ChEMBL_944293
IC50>10000±n/a nM
Citation Takeuchi, CSKim, BGBlazey, CMMa, SJohnson, HWAnand, NKArcalas, ABaik, TGBuhr, CACannoy, JEpshteyn, SJoshi, ALara, KLee, MSWang, LLeahy, JWNuss, JMAay, NAoyama, RFoster, PLee, JLehoux, IMunagala, NPlonowski, ARajan, SWoolfrey, JYamaguchi, KLamb, PMiller, N Discovery of a novel class of highly potent, selective, ATP-competitive, and orally bioavailable inhibitors of the mammalian target of rapamycin (mTOR). J Med Chem56:2218-34 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Apoptosis Signal-regulating Kinase 1 (ASK1)
Name:Mitogen-activated protein kinase kinase kinase 5
Synonyms:Mitogen-activated protein kinase kinase kinase 5
Type:Protein
Mol. Mass.:154514.93
Organism:Homo sapiens (Human)
Description:Q99683
Residue:1374
Sequence:
MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESA
AAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREAC
ETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANN
IILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQP
NFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIR
QRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALN
RRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGF
FLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVD
FWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIH
EWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRS
TEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQ
PLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTI
GFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVH
PEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNE
YLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGI
PDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEP
KLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNK
VLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEE
QPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVN
GADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429867
NameBDBM50429867
Synonyms:CHEMBL2333365
TypeSmall organic molecule
Emp. Form.C23H22FN3O4S
Mol. Mass.455.502
SMILESCc1c(F)c(ccc1C(=O)N1CCOc2ccc(cc2C1)-c1ccc(N)nc1)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a