Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid binding protein muscle
LigandBDBM50212873
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945782
IC50 14700±n/a nM
Citation Beniyama, YMatsuno, KMiyachi, H Structure-guided design, synthesis and in vitro evaluation of a series of pyrazole-based fatty acid binding protein (FABP) 3 ligands. Bioorg Med Chem Lett23:1662-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid binding protein muscle
Name:Fatty acid binding protein muscle
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:14858.36
Organism:Homo sapiens (Human)
Description:ChEMBL_1463784
Residue:133
Sequence:
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212873
NameBDBM50212873
Synonyms:((2'-(5-ETHYL-3,4-DIPHENYL-1H-PYRAZOL-1-YL)-3-BIPHENYLYL)OXY)ACETIC ACID | BMS309403 | CHEMBL247920 | [2'-(5-Ethyl-3,4-diphenyl-pyrazol-1-yl)-biphenyl-3-yloxy]-acetic acid
TypeSmall organic molecule
Emp. Form.C31H26N2O3
Mol. Mass.474.5497
SMILESCCc1c(c(nn1-c1ccccc1-c1cccc(OCC(O)=O)c1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a