Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM26992
Substrate/Competitorn/a
Meas. Tech.ChEMBL_943322
Ki 63000000±n/a nM
Citation Vullo, DIsik, SDel Prete, SDe Luca, VCarginale, VScozzafava, ASupuran, CTCapasso, C Anion inhibition studies of thea-carbonic anhydrase from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem Lett23:1636-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26992
NameBDBM26992
Synonyms:CHEMBL183495 | SO4(2-) | SODIUM SULFATE | sulfate | sulfate ion
TypeIon
Emp. Form.O4S
Mol. Mass.96.064
SMILES[O-]S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a