Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
LigandBDBM22971
Substrate/Competitorn/a
Meas. Tech.ChEMBL_942527
IC50 540±n/a nM
Citation Heinrich, DMFlanagan, JUJamieson, SMSilva, SRigoreau, LJTrivier, ERaynham, TTurnbull, APDenny, WA Synthesis and structure-activity relationships for 1-(4-(piperidin-1-ylsulfonyl)phenyl)pyrrolidin-2-ones as novel non-carboxylate inhibitors of the aldo-keto reductase enzyme AKR1C3. Eur J Med Chem62:738-44 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
Name:Aldo-keto-reductase family 1 member C3
Synonyms:3-alpha-HSD type 2 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Type:Enzyme
Mol. Mass.:36859.86
Organism:Homo sapiens (human)
Description:P42330
Residue:323
Sequence:
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22971
NameBDBM22971
Synonyms:2-[(2,6-dichloro-3-methylphenyl)amino]benzoic acid | CHEMBL509 | Meclofenamate | Meclofenamic acid
TypeSmall organic molecule
Emp. Form.C14H11Cl2NO2
Mol. Mass.296.149
SMILESCc1ccc(Cl)c(Nc2ccccc2C(O)=O)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a