Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-ketoglutarate-dependent dioxygenase FTO
LigandBDBM50371704
Substrate/Competitorn/a
Meas. Tech.ChEMBL_947323
IC50 11000±n/a nM
Citation Aik, WDemetriades, MHamdan, MKBagg, EAYeoh, KKLejeune, CZhang, ZMcDonough, MASchofield, CJ Structural basis for inhibition of the fat mass and obesity associated protein (FTO). J Med Chem56:3680-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-ketoglutarate-dependent dioxygenase FTO
Name:Alpha-ketoglutarate-dependent dioxygenase FTO
Synonyms:FTO | Fat mass and obesity-associated protein | KIAA1752
Type:PROTEIN
Mol. Mass.:58263.75
Organism:Homo sapiens
Description:ChEMBL_1515854
Residue:505
Sequence:
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEE
LHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPV
KGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVG
MGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
AVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDD
ASMPLPFDLTDIVSELRGQLLEAKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371704
NameBDBM50371704
Synonyms:CHEMBL270415
TypeSmall organic molecule
Emp. Form.C14H7BrNO5S
Mol. Mass.381.179
SMILESNc1c2C(=O)c3ccccc3C(=O)c2c(Br)cc1S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a