Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-amino-acid oxidase
LigandBDBM50431065
Substrate/Competitorn/a
Meas. Tech.ChEMBL_947856
IC50 8.8±n/a nM
Citation Hondo, TWarizaya, MNiimi, TNamatame, IYamaguchi, TNakanishi, KHamajima, THarada, KSakashita, HMatsumoto, YOrita, MTakeuchi, M 4-Hydroxypyridazin-3(2H)-one derivatives as novel D-amino acid oxidase inhibitors. J Med Chem56:3582-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-amino-acid oxidase
Name:D-amino-acid oxidase
Synonyms:D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO
Type:Homodimer
Mol. Mass.:39476.06
Organism:Homo sapiens (Human)
Description:P14920
Residue:347
Sequence:
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431065
n/a
NameBDBM50431065
Synonyms:CHEMBL2338799 | US10202399, Example 16
TypeSmall organic molecule
Emp. Form.C13H14N2O3
Mol. Mass.246.2619
SMILESCOc1cccc(CCc2cc(O)c(=O)[nH]n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: