Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-Amino Acid Oxidase (DAAO)
LigandBDBM50431065
Substrate/Competitorn/a
Meas. Tech.ChEMBL_947854
IC50 5.6±n/a nM
Citation Hondo, TWarizaya, MNiimi, TNamatame, IYamaguchi, TNakanishi, KHamajima, THarada, KSakashita, HMatsumoto, YOrita, MTakeuchi, M 4-Hydroxypyridazin-3(2H)-one derivatives as novel D-amino acid oxidase inhibitors. J Med Chem56:3582-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-Amino Acid Oxidase (DAAO)
Name:D-Amino Acid Oxidase (DAAO)
Synonyms:DAMOX | DAO
Type:Homodimer
Mol. Mass.:38824.91
Organism:Rattus norvegicus (rat)
Description:Recombinant rat DAAO expressed and purified from sf9 insect cells, was used in enzyme assays.
Residue:346
Sequence:
MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKSTVLGFRKLTPSE
LDMFPDYSYGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINC
TGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGV
FQLGNWSELNSVHDHNTIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERERLRFGSS
SAEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKNLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431065
n/a
NameBDBM50431065
Synonyms:CHEMBL2338799 | US10202399, Example 16
TypeSmall organic molecule
Emp. Form.C13H14N2O3
Mol. Mass.246.2619
SMILESCOc1cccc(CCc2cc(O)c(=O)[nH]n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: