Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid ceramidase (AC)
LigandBDBM50431268
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949261
IC50 1100±n/a nM
Citation Pizzirani, DPagliuca, CRealini, NBranduardi, DBottegoni, GMor, MBertozzi, FScarpelli, RPiomelli, DBandiera, T Discovery of a new class of highly potent inhibitors of acid ceramidase: synthesis and structure-activity relationship (SAR). J Med Chem56:3518-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acid ceramidase (AC)
Name:Acid ceramidase (AC)
Synonyms:AC | ACDase | Acid CDase | Acid ceramidase | Acylsphingosine deacylase | Asah1 | N-acylsphingosine amidohydrolase
Type:Enzyme
Mol. Mass.:44450.22
Organism:Rattus norvegicus (Rat)
Description:Q6P7S1
Residue:394
Sequence:
MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKR
WHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIAD
VTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEE
LKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMF
GKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKES
LDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTK
PVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431268
NameBDBM50431268
Synonyms:CHEMBL2333036 | US9428465, 9
TypeSmall organic molecule
Emp. Form.C12H19N3O4
Mol. Mass.269.297
SMILESCCCCCCNC(=O)n1cc(OC)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a