Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50431441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_952416
Ki 101±n/a nM
Citation Kusakabe, KTada, YIso, YSakagami, MMorioka, YChomei, NShinonome, SKawamoto, KTakenaka, HYasui, KHamana, HHanasaki, K Design, synthesis, and binding mode prediction of 2-pyridone-based selective CB2 receptor agonists. Bioorg Med Chem21:2045-55 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431441
NameBDBM50431441
Synonyms:CHEMBL2348063
TypeSmall organic molecule
Emp. Form.C18H20N2O2S
Mol. Mass.328.429
SMILESCCCCn1c(C)c(C)cc(Oc2nc3ccccc3o2)c1=S
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a