Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50353016
Substrate/Competitorn/a
Meas. Tech.ChEMBL_951228
Ki 7.0±n/a nM
Citation Schmitt, CVoegelin, MMarin, ASchmitt, MSchegg, FHénon, PGuenot, DTarnus, C Selective aminopeptidase-N (CD13) inhibitors with relevance to cancer chemotherapy. Bioorg Med Chem21:2135-44 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase N
Synonyms:ANPEP | AP-M | AP-N | Alanyl aminopeptidase | Aminopeptidase M | Aminopeptidase N (APN) | CD_antigen=CD13 | Microsomal aminopeptidase | gp130 | pAPN
Type:Protein
Mol. Mass.:108810.25
Organism:Sus scrofa (Pig)
Description:P15145
Residue:963
Sequence:
MAKGFYISKALGILGILLGVAAVATIIALSVVYAQEKNKNAEHVPQAPTSPTITTTAAIT
LDQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRLLCQEPTDVIIIHS
KKLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGE
LADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTA
LSNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWAR
PNAIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYREN
ALLFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHA
EPTWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIR
MLSNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWT
LQMGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRD
VSQAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIY
DSFNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLR
KQVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDP
ENNPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNR
YLGYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQ
GVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFI
EHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353016
NameBDBM50353016
Synonyms:CHEMBL1821978
TypeSmall organic molecule
Emp. Form.C17H17NO
Mol. Mass.251.323
SMILESNC1CCc2cccc(c2CC1=O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a