Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 13
LigandBDBM50431947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_953678
IC50 20000±n/a nM
Citation Atobe, MMaekawara, NIshiguro, NSogame, SSuenaga, YKawanishi, MSuzuki, HJinno, NTanaka, EMiyoshi, S A series of thiazole derivatives bearing thiazolidin-4-one as non-competitive ADAMTS-5 (aggrecanase-2) inhibitors. Bioorg Med Chem Lett23:2106-10 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 13
Name:A disintegrin and metalloproteinase with thrombospondin motifs 13
Synonyms:ADAM-TS 13 | ADAM-TS13 | ADAMTS-13 | ADAMTS13 | C9orf8 | vWF-CP | vWF-cleaving protease | von Willebrand factor-cleaving protease
Type:PROTEIN
Mol. Mass.:153616.59
Organism:Homo sapiens
Description:ChEMBL_953678
Residue:1427
Sequence:
MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP
PSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL
GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR
FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGS
GCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ
PGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTEC
GVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPRSPCSRSCGGGVVTRRRQCNNPRPAFGG
RACVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGAAVPHSQGD
ALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQ
VWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIG
GRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQEDADIQVYRR
YGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVE
TVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVRCVEAQGSLLKTL
PPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGADGLEA
PVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVWTPA
AGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLA
ACSVSCGRGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMS
LGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYRWHVGT
WMECSVSCGDGIQRRRDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVP
HEEAAAPGRTTATPAGASLEWSQARGLLFSPAPQPRRLLPGPQENSVQSSACGRQHLEPT
GTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLDM
TFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATS
NAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWE
SESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431947
NameBDBM50431947
Synonyms:CHEMBL2348091
TypeSmall organic molecule
Emp. Form.C15H13N3O3S2
Mol. Mass.347.412
SMILESOC(=O)CCc1sc(\C=C2/NC(=O)CS2)nc1-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a