Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50433055
Substrate/Competitorn/a
Meas. Tech.ChEMBL_955826
IC50 3120±n/a nM
Citation Jin, KZhang, XMa, CXu, YYuan, YXu, W Novel indoline-2,3-dione derivatives as inhibitors of aminopeptidase N (APN). Bioorg Med Chem21:2663-70 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase
Synonyms:Alanyl aminopeptidase | CD_antigen=CD13 | Microsomal aminopeptidase | Myeloid plasma membrane glycoprotein CD13 | gp150 | hAPN
Type:PROTEIN
Mol. Mass.:109522.63
Organism:Homo sapiens (Human)
Description:ChEMBL_1507526
Residue:967
Sequence:
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433055
NameBDBM50433055
Synonyms:CHEMBL2376113
TypeSmall organic molecule
Emp. Form.C14H15ClN2O5
Mol. Mass.326.732
SMILESONC(=O)CN1C(=O)C2(OCCCCO2)c2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a