Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-K
LigandBDBM50433369
Substrate/Competitorn/a
Meas. Tech.ChEMBL_956649
IC50 13±n/a nM
Citation Schonbrunn, EBetzi, SAlam, RMartin, MPBecker, AHan, HFrancis, RChakrasali, RJakkaraj, SKazi, ASebti, SMCubitt, CLGebhard, AWHazlehurst, LATash, JSGeorg, GI Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases. J Med Chem56:3768-82 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-K
Name:Cyclin-K
Synonyms:CCNK | CPR4
Type:PROTEIN
Mol. Mass.:64254.10
Organism:Homo sapiens (Human)
Description:ChEMBL_107901
Residue:580
Sequence:
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS
QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIET
THPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPP
NPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGL
PPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433369
NameBDBM50433369
Synonyms:CHEMBL2377825
TypeSmall organic molecule
Emp. Form.C16H13N5O5S2
Mol. Mass.419.435
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)sc1C(=O)c1ccccc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a