Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstate specific antigen
LigandBDBM50099216
Substrate/Competitorn/a
Meas. Tech.ChEMBL_959179
IC50 226±n/a nM
Citation Kostova, MBRosen, DMChen, YMease, RCDenmeade, SR Structural optimization, biological evaluation, and application of peptidomimetic prostate specific antigen inhibitors. J Med Chem56:4224-35 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostate specific antigen
Name:Prostate specific antigen
Synonyms:Gamma-seminoprotein | Kallikrein-3 | P-30 antigen | PSA | Prostate-specific antigen | Semenogelase | Seminin
Type:PROTEIN
Mol. Mass.:28747.53
Organism:Homo sapiens (Human)
Description:ChEMBL_959198
Residue:261
Sequence:
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099216
NameBDBM50099216
Synonyms:(2S,3S)-1-[2-(3-Benzyloxycarbonyl-phenyl)-acetyl]-3-(4-hydroxy-benzyl)-4-oxo-azetidine-2-carboxylic acid benzyl ester | 1-[2-(3-Benzyloxycarbonyl-phenyl)-acetyl]-3-(4-hydroxy-benzyl)-4-oxo-azetidine-2-carboxylic acid benzyl ester | CHEMBL286934
TypeSmall organic molecule
Emp. Form.C34H29NO7
Mol. Mass.563.5966
SMILESOc1ccc(C[C@H]2[C@H](N(C(=O)Cc3cccc(c3)C(=O)OCc3ccccc3)C2=O)C(=O)OCc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a