Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM50241089
Substrate/Competitorn/a
Meas. Tech.ChEMBL_965032
Ki 0.370000±n/a nM
Citation Zheng, YZheng, MLing, XLiu, YXue, YAn, LGu, NJi, MJin, M Design, synthesis, quantum chemical studies and biological activity evaluation of pyrazole-benzimidazole derivatives as potent Aurora A/B kinase inhibitors. Bioorg Med Chem Lett23:3523-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50241089
NameBDBM50241089
Synonyms:2-(ethyl(3-(4-(5-(2-(3-fluorophenylamino)-2-oxoethyl)-1H-pyrazol-3-ylamino)quinazolin-7-yloxy)propyl)amino)ethyl dihydrogen phosphate | 2-ethyl3-4-5-2-3-fluorophenylamino)-2-oxoethyl)-1H-pyrazol-3-ylamino)quinazolin-7-yloxy)propyl)amino)ethyl dihydrogen phosphate | AZD1152, 33 | CHEMBL415049
TypeSmall organic molecule
Emp. Form.C26H31FN7O6P
Mol. Mass.587.5398
SMILESCCN(CCCOc1ccc2c(Nc3cc(CC(=O)Nc4cccc(F)c4)n[nH]3)ncnc2c1)CCOP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a