Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-chymotrypsin
LigandBDBM50437999
Substrate/Competitorn/a
Meas. Tech.ChEMBL_972955
IC50 15±n/a nM
Citation Crocetti, LSchepetkin, IACilibrizzi, AGraziano, AVergelli, CGiomi, DKhlebnikov, AIQuinn, MTGiovannoni, MP Optimization of N-benzoylindazole derivatives as inhibitors of human neutrophil elastase. J Med Chem56:6259-72 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-chymotrypsin
Name:Beta-chymotrypsin
Synonyms:Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B
Type:PROTEIN
Mol. Mass.:27871.19
Organism:Homo sapiens (Human)
Description:ChEMBL_216634
Residue:263
Sequence:
MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437999
NameBDBM50437999
Synonyms:CHEMBL2409452
TypeSmall organic molecule
Emp. Form.C17H13N3O5
Mol. Mass.339.3022
SMILESCOC(=O)c1nn(C(=O)c2cccc(C)c2)c2ccc(cc12)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a