Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcidic alpha-glucosidase
LigandBDBM50438500
Substrate/Competitorn/a
Meas. Tech.ChEMBL_976219
Ki 4800±n/a nM
Citation Bian, XFan, XKe, CLuan, YZhao, GZeng, A Synthesis anda-glucosidase inhibitory activity evaluation of N-substituted aminomethyl--d-glucopyranosides. Bioorg Med Chem21:5442-50 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acidic alpha-glucosidase
Name:Acidic alpha-glucosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:106191.24
Organism:Rattus norvegicus
Description:ChEMBL_1506157
Residue:953
Sequence:
MNIRKPLCSNSVVGACTLVSLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQES
YEPAPLHIQEHAEQLRAVPTQCDVTPNSRFDCAPDKGITQEQCEARGCCWVPAGQVLNGP
VMGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLH
FMIKDPTSKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVLLNTTVAPLF
FADQFLQLSTSLPSQHIAGLGEHLSPLMLSTEWTRITLWNRDVAPSQGVNLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDG
FADFPDMVHELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRGSQQGCPDNELEN
PPYVPGVVGGALQAATICASSHQFLSTHYNLHNLYGLTEAIASSRALVKTRGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEHLAYSVPEILQFNLLGVPLVGADICGFQGNTTEELCVR
WTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHVKG
DTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTDVTGYFPKGMWYNLQMVPV
ETLGSLPSSSPASSFRSIVHSKGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQ
PMALAVALTESGEASGELFWDDGESLGVLERGAYTLVTFSAKNNTIVNKLVHVTKEGGEL
QLREVTILGVTTAPTQVLSNGISVSNFTYSPDDKSLSIPVSLLMGERFQIDWS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50438500
n/a
NameBDBM50438500
Synonyms:CHEMBL2414822
TypeSmall organic molecule
Emp. Form.C20H25NO10
Mol. Mass.439.4132
SMILESCC(=O)Oc1ccc(\C=C\C(=O)NC[C@@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@H]2O)cc1OC(C)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: