Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTumor necrosis factor receptor superfamily member 6
LigandBDBM50439384
Substrate/Competitorn/a
Meas. Tech.ChEMBL_979855
EC50 1585±n/a nM
Citation Jung, SHSuh, JHKim, EHKim, JTYoo, SEKang, NS The discovery of inhibitors of Fas-mediated cell death pathway using the combined computational method. Bioorg Med Chem Lett23:5155-64 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tumor necrosis factor receptor superfamily member 6
Name:Tumor necrosis factor receptor superfamily member 6
Synonyms:Apo-1 antigen | Apoptosis-mediating surface antigen FAS | Apt1 | CD_antigen=CD95 | FASLG receptor | Fas | Tnfrsf6
Type:PROTEIN
Mol. Mass.:36836.00
Organism:Rattus norvegicus
Description:ChEMBL_107643
Residue:324
Sequence:
MLWIMAVLPLVLAGPELNVRMQGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQ
PGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQN
TKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGL
AILFVFIYKRYRKRQPGDPESGIPSPESVPMNVSDVNLNKYIWRTAEKMKICDAKKFARQ
HKIPESKIDEIEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQ
AMVWEDHENSISNSRNENEGQSLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50439384
n/a
NameBDBM50439384
Synonyms:CHEMBL2420407
TypeSmall organic molecule
Emp. Form.C22H16Br3NO3S
Mol. Mass.614.144
SMILESCOC(=O)c1cc(Br)cc(Br)c1NC(=O)C(Sc1ccc(Br)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: