Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSUMO-activating enzyme subunit 2 (SAE2)
LigandBDBM50439437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_977623
IC50 35700±n/a nM
Citation Kumar, AIto, AHirohama, MYoshida, MZhang, KY Identification of quinazolinyloxy biaryl urea as a new class of SUMO activating enzyme 1 inhibitors. Bioorg Med Chem Lett23:5145-9 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SUMO-activating enzyme subunit 2 (SAE2)
Name:SUMO-activating enzyme subunit 2 (SAE2)
Synonyms:6.3.2.- | Anthracycline-associated resistance ARX | SAE2 | SUMO-activating enzyme subunit 2 | UBA2 | UBLE1B | Ubiquitin-like 1-activating enzyme E1B | Ubiquitin-like modifier-activating enzyme 2
Type:Enzyme
Mol. Mass.:71206.17
Organism:Homo sapiens (Human)
Description:Q9UBT2
Residue:640
Sequence:
MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN
ADVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50439437
NameBDBM50439437
Synonyms:CHEMBL1572155
TypeSmall organic molecule
Emp. Form.C21H13ClF3N5O2
Mol. Mass.459.808
SMILESFC(F)(F)c1ccc(NC(=O)Nc2ccc(Oc3ncnc4cc(Cl)ccc34)nc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a