Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-acylethanolamine-hydrolyzing acid amidase
LigandBDBM50439664
Substrate/Competitorn/a
Meas. Tech.ChEMBL_978419
IC50 7.0±n/a nM
Citation Ponzano, SBertozzi, FMengatto, LDionisi, MArmirotti, ARomeo, EBerteotti, AFiorelli, CTarozzo, GReggiani, ADuranti, ATarzia, GMor, MCavalli, APiomelli, DBandiera, T Synthesis and structure-activity relationship (SAR) of 2-methyl-4-oxo-3-oxetanylcarbamic acid esters, a class of potent N-acylethanolamine acid amidase (NAAA) inhibitors. J Med Chem56:6917-34 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
N-acylethanolamine-hydrolyzing acid amidase
Name:N-acylethanolamine-hydrolyzing acid amidase
Synonyms:ASAH-like protein | ASAHL | Acid ceramidase-like protein | N-acylsphingosine amidohydrolase-like | N-acylsphingosine-amidohydrolase | NAAA | PLT
Type:Enzyme
Mol. Mass.:40073.12
Organism:Homo sapiens (Human)
Description:Q02083
Residue:359
Sequence:
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLV
RAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAY
ESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGL
WTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKT
PLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDR
RTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50439664
NameBDBM50439664
Synonyms:CHEMBL2419814 | US9353075, 17
TypeSmall organic molecule
Emp. Form.C18H17NO4
Mol. Mass.311.3319
SMILESC[C@@H]1OC(=O)[C@@H]1NC(=O)OCc1ccc(cc1)-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a