Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetScm-like with four MBT domains protein 1
LigandBDBM50440594
Substrate/Competitorn/a
Meas. Tech.ChEMBL_983406
IC50>10000±n/a nM
Citation James, LIKorboukh, VKKrichevsky, LBaughman, BMHerold, JMNorris, JLJin, JKireev, DBJanzen, WPArrowsmith, CHFrye, SV Small-molecule ligands of methyl-lysine binding proteins: optimization of selectivity for L3MBTL3. J Med Chem56:7358-71 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Scm-like with four MBT domains protein 1
Name:Scm-like with four MBT domains protein 1
Synonyms:RU1 | Renal ubiquitous protein 1 | SFMBT1 | hSFMBT
Type:PROTEIN
Mol. Mass.:98135.34
Organism:Homo sapiens (Human)
Description:ChEMBL_104121
Residue:866
Sequence:
MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAV
RTDPETYWVATVITTCEQLLLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAP
EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTW
IVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKN
EAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKV
FDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPGYPSQDFDWAD
YLKQCGAEAAPQRCFPPLISEHEFKENMKLEAVNPILPEEVCVATITAVRGSYLWLQLEG
SKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVH
EGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLRE
VLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKGKSYRATVEIVKTADRVTEFC
RQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACA
LKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGEDEDDPDEGDDDSLSEGSTSE
QQDELQEESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDENKPPSPKEIR
IEVAERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMD
LKLGPAIKLCHHIERIKFAFYEQFAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440594
NameBDBM50440594
Synonyms:CHEMBL2426487
TypeSmall organic molecule
Emp. Form.C28H41N3O2
Mol. Mass.451.644
SMILESO=C(N1CCC(CC1)C1CCCCC1)c1ccc(cc1)C(=O)N1CCC(CC1)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a