Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase (UHRF1)
LigandBDBM50440594
Substrate/Competitorn/a
Meas. Tech.ChEMBL_983403
IC50>10000±n/a nM
Citation James, LIKorboukh, VKKrichevsky, LBaughman, BMHerold, JMNorris, JLJin, JKireev, DBJanzen, WPArrowsmith, CHFrye, SV Small-molecule ligands of methyl-lysine binding proteins: optimization of selectivity for L3MBTL3. J Med Chem56:7358-71 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase (UHRF1)
Name:E3 ubiquitin-protein ligase (UHRF1)
Synonyms:6.3.2.- | E3 ubiquitin-protein ligase UHRF1 | HuNp95 | ICBP90 | Inverted CCAAT box-binding protein of 90 kDa | NP95 | Nuclear protein 95 | Nuclear zinc finger protein Np95 | RING finger protein 106 | RNF106 | Transcription factor ICBP90 | UHRF1 | Ubiquitin-like PHD and RING finger domain-containing protein 1 | Ubiquitin-like-containing PHD and RING finger domains protein 1 | hNp95 | hUHRF1
Type:Protein
Mol. Mass.:89822.48
Organism:Homo sapiens (Human)
Description:n/a
Residue:793
Sequence:
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD
YEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSR
PADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEE
DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYD
AEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYC
PECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTG
SGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVK
GGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
SPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEE
TFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQT
VLNQLFPGYGNGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440594
NameBDBM50440594
Synonyms:CHEMBL2426487
TypeSmall organic molecule
Emp. Form.C28H41N3O2
Mol. Mass.451.644
SMILESO=C(N1CCC(CC1)C1CCCCC1)c1ccc(cc1)C(=O)N1CCC(CC1)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a