Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMBT domain-containing protein 1 (MBTD1)
LigandBDBM50440606
Substrate/Competitorn/a
Meas. Tech.ChEMBL_983404
IC50 3500±n/a nM
Citation James, LIKorboukh, VKKrichevsky, LBaughman, BMHerold, JMNorris, JLJin, JKireev, DBJanzen, WPArrowsmith, CHFrye, SV Small-molecule ligands of methyl-lysine binding proteins: optimization of selectivity for L3MBTL3. J Med Chem56:7358-71 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MBT domain-containing protein 1 (MBTD1)
Name:MBT domain-containing protein 1 (MBTD1)
Synonyms:MBT domain-containing protein 1
Type:Protein
Mol. Mass.:70557.67
Organism:Homo sapiens (Human)
Description:n/a
Residue:628
Sequence:
MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMATCEMCGMV
GVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYA
QYQATLQNQAKTKAAVSMEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEV
PNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGK
PLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLC
RTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQ
DGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGID
GSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPV
KLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCE
SPDLYPVGWCQLTGYQLQPPASQSSRENQSASSKQKKKAKSQQYKGHKKMTTLQLKEELL
DGEDYNFLQGASDQESNGSANFYIKQEP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440606
NameBDBM50440606
Synonyms:CHEMBL2426376
TypeSmall organic molecule
Emp. Form.C33H39N5O2
Mol. Mass.537.6951
SMILESCCN1Cc2ccc(NC(=O)c3ccc(cc3Nc3ccccc3)C(=O)N3CCC(CC3)C3CCCN3)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a