Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM50399632
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1278685
Ki 52±n/a nM
Citation Fontenelle, CQWang, ZFossey, CCailly, TLinclau, BFabis, F Design of fluorinated 5-HT(4)R antagonists: influence of the basicity and lipophilicity toward the 5-HT(4)R binding affinities. Bioorg Med Chem21:7529-38 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR4
Name:Serotonin 4 (5-HT4) receptor
Synonyms:5-HT4 | 5-hydroxytryptamine receptor 4 | Serotonin 4 (5-HT4) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43735.29
Organism:GUINEA PIG
Description:5-HT4 HTR4 GUINEA PIG::O70528
Residue:388
Sequence:
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRP
QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
TVECGGQWESQCHPAASSPLVAAQPIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399632
NameBDBM50399632
Synonyms:CHEMBL2177145
TypeSmall organic molecule
Emp. Form.C22H26N2O
Mol. Mass.334.4546
SMILESCCCN1CCC(COc2nc3ccccc3c3ccccc23)CC1
Structure
n/a