Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-binding cassette sub-family G member 2
LigandBDBM3264
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1278745
IC50 1480±n/a nM
Citation Juvale, KGallus, JWiese, M Investigation of quinazolines as inhibitors of breast cancer resistance protein (ABCG2). Bioorg Med Chem21:7858-73 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-binding cassette sub-family G member 2
Name:ATP-binding cassette sub-family G member 2
Synonyms:ABCP | ATP-Binding Cassette Transporter ABCG2 | ATP-binding cassette sub-family G member 2 | ATP-binding cassette transporter (ABCG2) | ATP-binding cassette, sub-family G, member 2 | BCRP | BCRP1 | Breast cancer resistance protein | CDw338 | MXR | Mitoxantrone resistance-associated protein | Placenta-specific ATP-binding cassette transporter | Urate exporter
Type:Multi-pass membrane protein; monomer or homodimer; disulfide-linked
Mol. Mass.:72329.48
Organism:Homo sapiens (Human)
Description:Q9UNQ0
Residue:655
Sequence:
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3264
NameBDBM3264
Synonyms:4-Anilino quinazoline deriv. 15 | CHEMBL290096 | N-(3-bromophenyl)quinazolin-4-amine
TypeSmall organic molecule
Emp. Form.C14H10BrN3
Mol. Mass.300.153
SMILESBrc1cccc(Nc2ncnc3ccccc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a