Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM50445152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1284449
Ki 92±n/a nM
Citation Burger, MTHan, WLan, JNishiguchi, GBellamacina, CLindval, MAtallah, GDing, YMathur, MMcBride, CBeans, ELMuller, KTamez, VZhang, YHuh, KFeucht, PZavorotinskaya, TDai, YHolash, JCastillo, JLangowski, JWang, YChen, MYGarcia, PD Structure Guided Optimization, in Vitro Activity, and in Vivo Activity of Pan-PIM Kinase Inhibitors. ACS Med Chem Lett4:1193-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50445152
NameBDBM50445152
Synonyms:CHEMBL3103881
TypeSmall organic molecule
Emp. Form.C17H20N4O2S
Mol. Mass.344.431
SMILESCC(=O)Nc1nc(cs1)C(=O)Nc1ccccc1N1CCCCC1
Structure
n/a