Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase-1
LigandBDBM7458
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1284051
Ki 178300±n/a nM
Citation Ribeiro, DFreitas, MTomé, SMSilva, AMPorto, GCabrita, EJMarques, MMFernandes, E Inhibition of LOX by flavonoids: a structure-activity relationship study. Eur J Med Chem72:137-45 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoxygenase-1
Name:Seed lipoxygenase-1
Synonyms:15-LOX | 15-Lipo-oxygenase (15-LO) | 15-lipo-oxygenase (SLO) | Arachidonic Acid 15- Lipoxygenase | L-1 | Lipoxygenase (LOX) | Lipoxygenase (SLO) | Seed lipoxygenase-1
Type:Enzyme
Mol. Mass.:94365.66
Organism:Glycine max (soybean)
Description:n/a
Residue:839
Sequence:
MFSAGHKIKGTVVLMPKNELEVNPDGSAVDNLNAFLGRSVSLQLISATKADAHGKGKVGK
DTFLEGINTSLPTLGAGESAFNIHFEWDGSMGIPGAFYIKNYMQVEFFLKSLTLEAISNQ
GTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVSYREEELKSLRGNGTGERKEY
DRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRGRTGRGPTVTDPNTEKQGEVFYV
PRDENLGHLKSKDALEIGTKSLSQIVQPAFESAFDLKSTPIEFHSFQDVHDLYEGGIKLP
RDVISTIIPLPVIKELYRTDGQHILKFPQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIR
GLEEFPPKSNLDPAIYGDQSSKITADSLDLDGYTMDEALGSRRLFMLDYHDIFMPYVRQI
NQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWL
LAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINA
LARQSLINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG
VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEKGHGDL
KDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTASRRLLPEKGT
PEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLGQRDNPHWTSDSKALQ
AFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLLYPSSEEGLTFRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7458
NameBDBM7458
Synonyms:5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | cid_5280443
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a