Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase 3A1 (ALDH3A1)
LigandBDBM50447073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1289633
IC50 1500±n/a nM
Citation Parajuli, BFishel, MLHurley, TD Selective ALDH3A1 inhibition by benzimidazole analogues increase mafosfamide sensitivity in cancer cells. J Med Chem57:449-61 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase 3A1 (ALDH3A1)
Name:Aldehyde dehydrogenase 3A1 (ALDH3A1)
Synonyms:Aldehyde dehydrogenase family 3 member A1 (ALDH3A1) | Aldehyde dehydrogenase family 3 member A1 (ALDH3A1) (Q122A)
Type:Protein
Mol. Mass.:50394.38
Organism:Homo sapiens (Human)
Description:n/a
Residue:453
Sequence:
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447073
n/a
NameBDBM50447073
Synonyms:CHEMBL1493289 | US9328112, A21
TypeSmall organic molecule
Emp. Form.C13H9ClN2O2S
Mol. Mass.292.741
SMILESClc1ccc(cc1)S(=O)(=O)n1cnc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: