Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 6/G1/S-specific cyclin D1
LigandBDBM50447512
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1288875
IC50 9.8±n/a nM
Citation Reddy, MVAkula, BCosenza, SCAthuluridivakar, SMallireddigari, MRPallela, VRBilla, VKSubbaiah, DRBharathi, EVVasquez-Del Carpio, RPadgaonkar, ABaker, SJReddy, EP Discovery of 8-cyclopentyl-2-[4-(4-methyl-piperazin-1-yl)-phenylamino]-7-oxo-7,8-dihydro-pyrido[2,3-d]pyrimidine-6-carbonitrile (7x) as a potent inhibitor of cyclin-dependent kinase 4 (CDK4) and AMPK-related kinase 5 (ARK5). J Med Chem57:578-99 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 6/G1/S-specific cyclin D1
Name:Cyclin-dependent kinase 6/G1/S-specific cyclin D1
Synonyms:CDK6/cyclin D1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 640754
Components:This complex has 2 components.
Component 1
Name:Cyclin-dependent kinase 6
Synonyms:CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE
Type:Enzyme Subunit
Mol. Mass.:36937.42
Organism:Homo sapiens (Human)
Description:Q00534
Residue:326
Sequence:
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:G1/S-specific cyclin-D1
Synonyms:B-cell lymphoma 1 protein | BCL-1 | BCL-1 oncogene | CCND1 | PRAD1 oncogene
Type:Enzyme Subunit
Mol. Mass.:33717.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:295
Sequence:
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447512
NameBDBM50447512
Synonyms:CHEMBL3115681
TypeSmall organic molecule
Emp. Form.C24H27N7O
Mol. Mass.429.5175
SMILESCN1CCN(CC1)c1ccc(Nc2ncc3cc(C#N)c(=O)n(C4CCCC4)c3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a